Recombinant Human TRPC1 protein(31-100 aa), C-His-tagged

• Cat.No.: TRPC1-2776H
• Product Overview: Recombinant Human TRPC1 protein(P48995)(31-100 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 31-100 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: VMALKDVREVKEENTLNEKLFLLACDKGDYYMVKKILEENSSGDLNINCVDVLGRNAVTITIENENLDIL
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: TRPC1 transient receptor potential cation channel, subfamily C, member 1 [ Homo sapiens ]
• Official Symbol: TRPC1
• Synonyms: TRPC1; transient receptor potential cation channel, subfamily C, member 1; short transient receptor potential channel 1; HTRP 1; TRP-1; transient receptor protein 1; transient receptor potential canonical 1; TRP1; HTRP-1; MGC133334; MGC133335
• Gene ID: 7220
• mRNA Refseq: NM_001251845
• Protein Refseq: NP_001238774
• MIM: 602343
• UniProt ID: P48995