Recombinant Human TRPC1 protein(31-100 aa), C-His-tagged
Cat.No. : | TRPC1-2776H |
Product Overview : | Recombinant Human TRPC1 protein(P48995)(31-100 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 31-100 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | VMALKDVREVKEENTLNEKLFLLACDKGDYYMVKKILEENSSGDLNINCVDVLGRNAVTITIENENLDIL |
Gene Name | TRPC1 transient receptor potential cation channel, subfamily C, member 1 [ Homo sapiens ] |
Official Symbol | TRPC1 |
Synonyms | TRPC1; transient receptor potential cation channel, subfamily C, member 1; short transient receptor potential channel 1; HTRP 1; TRP-1; transient receptor protein 1; transient receptor potential canonical 1; TRP1; HTRP-1; MGC133334; MGC133335; |
Gene ID | 7220 |
mRNA Refseq | NM_001251845 |
Protein Refseq | NP_001238774 |
MIM | 602343 |
UniProt ID | P48995 |
◆ Cell & Tissue Lysates | ||
TRPC1-746HCL | Recombinant Human TRPC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRPC1 Products
Required fields are marked with *
My Review for All TRPC1 Products
Required fields are marked with *
0
Inquiry Basket