Recombinant Human TRMT112 Protein (1-125 aa), His-SUMO-tagged

• Cat.No.: TRMT112-1148H
• Product Overview: Recombinant Human TRMT112 Protein (1-125 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length.

Specification

• Description: Participates both in methylation of protein and tRNA species. The heterodimer with HK2/N6AMT1 catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. The heterodimer with ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA species.
• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 30.2 kDa
• Protein length: 1-125 aa
• AA Sequence: MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: TRMT112
• Synonyms: TRMT112; HSPC152; HSPC170; TRM112; TRMT11 2; TRMT11-2
• Gene ID: 51504
• mRNA Refseq: NM_016404
• Protein Refseq: NP_057488
• UniProt ID: Q9UI30