Recombinant Human TRMT112 Protein (1-125 aa), His-SUMO-tagged
Cat.No. : | TRMT112-1148H |
Product Overview : | Recombinant Human TRMT112 Protein (1-125 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-125 aa |
Description : | Participates both in methylation of protein and tRNA species. The heterodimer with HK2/N6AMT1 catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. The heterodimer with ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA species. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 30.2 kDa |
AA Sequence : | MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | TRMT112 |
Synonyms | TRMT112; HSPC152; HSPC170; TRM112; TRMT11 2; TRMT11-2; |
Gene ID | 51504 |
mRNA Refseq | NM_016404 |
Protein Refseq | NP_057488 |
UniProt ID | Q9UI30 |
◆ Recombinant Proteins | ||
TRMT112-4794R | Recombinant Rhesus Macaque TRMT112 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRMT112-5654HF | Recombinant Full Length Human TRMT112 Protein, GST-tagged | +Inquiry |
TRMT112-4980R | Recombinant Rhesus monkey TRMT112 Protein, His-tagged | +Inquiry |
TRMT112-1148H | Recombinant Human TRMT112 Protein (1-125 aa), His-SUMO-tagged | +Inquiry |
TRMT112-1958HFL | Recombinant Full Length Human TRMT112 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRMT112-756HCL | Recombinant Human TRMT112 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRMT112 Products
Required fields are marked with *
My Review for All TRMT112 Products
Required fields are marked with *
0
Inquiry Basket