Recombinant Full Length Human TRMT112 Protein, GST-tagged

Cat.No. : TRMT112-5654HF
Product Overview : Human HSPC152 full-length ORF ( AAH17172, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 125 amino acids
Description : TRMT112 (TRNA Methyltransferase 11-2 Homolog (S. Cerevisiae)) is a Protein Coding gene. Among its related pathways are rRNA processing in the nucleus and cytosol and Gene Expression. GO annotations related to this gene include protein methyltransferase activity.
Molecular Mass : 39.49 kDa
AA Sequence : MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol TRMT112
Synonyms TRMT112; tRNA methyltransferase 11-2 homolog (S. cerevisiae); tRNA methyltransferase 112 homolog; HSPC152; HSPC170; TRM112; TRMT11 2; TRM112-like protein; TRMT11-2;
Gene ID 51504
mRNA Refseq NM_016404
Protein Refseq NP_057488
MIM 618630
UniProt ID Q9UI30

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TRMT112 Products

Required fields are marked with *

My Review for All TRMT112 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon