Recombinant Full Length Human TRMT112 Protein, GST-tagged

• Cat.No.: TRMT112-5654HF
• Product Overview: Human HSPC152 full-length ORF ( AAH17172, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: TRMT112 (TRNA Methyltransferase 11-2 Homolog (S. Cerevisiae)) is a Protein Coding gene. Among its related pathways are rRNA processing in the nucleus and cytosol and Gene Expression. GO annotations related to this gene include protein methyltransferase activity.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 39.49 kDa
• Protein length: 125 amino acids
• AA Sequence: MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: TRMT112
• Synonyms: TRMT112; tRNA methyltransferase 11-2 homolog (S. cerevisiae); tRNA methyltransferase 112 homolog; HSPC152; HSPC170; TRM112; TRMT11 2; TRM112-like protein; TRMT11-2
• Gene ID: 51504
• mRNA Refseq: NM_016404
• Protein Refseq: NP_057488
• MIM: 618630
• UniProt ID: Q9UI30