Recombinant Human TRIT1, His-tagged
Cat.No. : | TRIT1-31617TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 188-467 of Human TRIT1 with an N terminal His tag. Predicted MWt 33 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 188-467 a.a. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 58 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SLQVFEETGISHSEFLHRQHTEEGGGPLGGPLKFSNPCIL WLHADQAVLDERLDKRVDDMLAAGLLEELRDFHRRYNQ KNVSENSQDYQHGIFQSIGFKEFHEYLITEGKCTLETS NQLLKKGIEALKQVTKRYARKQNRWVKNRFLSRPGPIV PPVYGLEVSDVSKWEESVLEPALEIVQSFIQGHKPTATPI KMPYNEAENKRSYHLCDLCDRIIIGDREWAAHIKSKSH LNQLKKRRRLDSDAVNTIESQSVSPDHNKEPKEKGSPG QNDQELKCSV |
Sequence Similarities : | Belongs to the IPP transferase family.Contains 1 matrin-type zinc finger. |
Gene Name | TRIT1 tRNA isopentenyltransferase 1 [ Homo sapiens ] |
Official Symbol | TRIT1 |
Synonyms | TRIT1; tRNA isopentenyltransferase 1; tRNA dimethylallyltransferase, mitochondrial; FLJ20061; IPT; |
Gene ID | 54802 |
mRNA Refseq | NM_017646 |
Protein Refseq | NP_060116 |
Uniprot ID | Q9H3H1 |
Chromosome Location | 1p34.2 |
Pathway | Metabolic pathways, organism-specific biosystem; |
Function | ATP binding; metal ion binding; nucleotide binding; tRNA dimethylallyltransferase activity; transferase activity; |
◆ Recombinant Proteins | ||
AKAP12B-8337Z | Recombinant Zebrafish AKAP12B | +Inquiry |
BHMT2-0758H | Recombinant Human BHMT2 Protein (Met1-Phe363), N-His tagged | +Inquiry |
RFL10619IF | Recombinant Full Length Ipomoea Purpurea Atp Synthase Subunit C, Chloroplastic(Atph) Protein, His-Tagged | +Inquiry |
APPL1-0140H | Recombinant Human APPL1 Protein (Phe404-Ser673), His-tagged | +Inquiry |
Gdf5-7211M | Recombinant Mouse Gdf5 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Hemoglobin F-034H | Native Human Hemoglobin F Protein | +Inquiry |
CA-242-380H | Active Native Human Cancer Antigen 242 | +Inquiry |
SERPING1-97H | Active Native Human C1 Esterase Inhibitor (C1-INH) | +Inquiry |
IgM-235H | Native Human Immunoglobulin M (IgM) | +Inquiry |
TG-121B | Native Bovine TG | +Inquiry |
◆ Cell & Tissue Lysates | ||
Colon-840P | Pig Colon Membrane Lysate, Total Protein | +Inquiry |
SECTM1-1946HCL | Recombinant Human SECTM1 cell lysate | +Inquiry |
LY6E-4601HCL | Recombinant Human LY6E 293 Cell Lysate | +Inquiry |
PCDHGA10-1301HCL | Recombinant Human PCDHGA10 cell lysate | +Inquiry |
PDK3-3328HCL | Recombinant Human PDK3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRIT1 Products
Required fields are marked with *
My Review for All TRIT1 Products
Required fields are marked with *
0
Inquiry Basket