Recombinant Human TRIM63

Cat.No. : TRIM63-30260TH
Product Overview : Recombinant fragment corresponding to amino acids 254-352 of Human MURF1 with a proprietary tag; Predicted MWt 36.52 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 99 amino acids
Description : This gene encodes a member of the RING zinc finger protein family found in striated muscle and iris. The product of this gene is localized to the Z-line and M-line lattices of myofibrils, where titins N-terminal and C-terminal regions respectively bind to the sarcomere. In vitro binding studies have shown that this protein also binds directly to titin near the region of titin containing kinase activity. Another member of this protein family binds to microtubules. Since these family members can form heterodimers, this suggests that these proteins may serve as a link between titin kinase and microtubule-dependent signal pathways in muscle.
Molecular Weight : 36.520kDa inclusive of tags
Tissue specificity : Muscle specific. Selectively expressed in heart and skeletal muscle. Also expressed in the iris.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQGFENMDFFTLDLEHIADALRAIDFGTDEEEEEFIEEEDQEEEESTEGKEEGH
Sequence Similarities : Contains 1 B box-type zinc finger.Contains 1 COS domain.Contains 1 RING-type zinc finger.
Gene Name TRIM63 tripartite motif containing 63 [ Homo sapiens ]
Official Symbol TRIM63
Synonyms TRIM63; tripartite motif containing 63; ring finger protein 28 , RNF28, tripartite motif containing 63; E3 ubiquitin-protein ligase TRIM63; IRF; iris ring finger protein; MURF 1; muscle specific RING finger protein 1; SMRZ; striated muscle RING zinc fing
Gene ID 84676
mRNA Refseq NM_032588
Protein Refseq NP_115977
MIM 606131
Uniprot ID Q969Q1
Chromosome Location 1p34-p33
Pathway Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem;
Function ligase activity; metal ion binding; signal transducer activity; titin binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TRIM63 Products

Required fields are marked with *

My Review for All TRIM63 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon