Recombinant Human TRIM37

• Cat.No.: TRIM37-31610TH
• Product Overview: Recombinant fragment of Human TRIM37 with an N-terminal proprietary tag; Predicted MW 36.63 kDa

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• ProteinLength: 100 amino acids
• Description: This gene encodes a member of the tripartite motif (TRIM) family, whose members are involved in diverse cellular functions such as developmental patterning and oncogenesis. The TRIM motif includes zinc-binding domains, a RING finger region, a B-box motif and a coiled-coil domain. The RING finger and B-box domains chelate zinc and might be involved in protein-protein and/or protein-nucleic acid interactions. The gene mutations are associated with mulibrey (muscle-liver-brain-eye) nanism, an autosomal recessive disorder that involves several tissues of mesodermal origin. Alternatively spliced transcript variants encoding the same protein have been identified.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Ubiquitous.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GHLEGLQMTDLENNSETGELQPVLPEGASAAPEEGMSSDSDIECDTENEEQEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQIGPEDLSFNTDENSGR
• Sequence Similarities: Belongs to the TRIM/RBCC family.Contains 1 B box-type zinc finger.Contains 1 MATH domain.Contains 1 RING-type zinc finger.

Gene Information

• Gene Name: TRIM37 tripartite motif containing 37 [ Homo sapiens ]
• Official Symbol: TRIM37
• Synonyms: TRIM37; tripartite motif containing 37; MUL, tripartite motif containing 37; E3 ubiquitin-protein ligase TRIM37; KIAA0898; POB1; RING B box coiled coil protein; TEF3
• Gene ID: 4591
• mRNA Refseq: NM_001005207
• Protein Refseq: NP_001005207
• MIM: 605073
• Uniprot ID: O94972
• Chromosome Location: 17q
• Pathway: Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem
• Function: ligase activity; metal ion binding; protein binding; zinc ion binding