Recombinant Human TREX2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TREX2-4316H
• Product Overview: TREX2 MS Standard C13 and N15-labeled recombinant protein (NP_542432) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a nuclear protein with 3' to 5' exonuclease activity. The encoded protein participates in double-stranded DNA break repair, and may interact with DNA polymerase delta.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 25.9 kDa
• AA Sequence: MSEAPRAETFVFLDLEATGLPSVEPEIAELSLFAVHRSSLENPEHDESGALVLPRVLDKLTLCMCPERPFTAKASEITGLSSEGLARCRKAGFDGAVVRTLQAFLSRQAGPICLVAHNGFDYDFPLLCAELRRLGARLPRDTVCLDTLPALRGLDRAHSHGTRARGRQGYSLGSLFHRYFRAEPSAAHSAEGDVHTLLLIFLHRAAELLAWADEQARGWAHIEPMYLPPDDPSLEATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TREX2 three prime repair exonuclease 2 [ Homo sapiens (human) ]
• Official Symbol: TREX2
• Synonyms: TREX2; three prime repair exonuclease 2; 3-5 exonuclease TREX2 long form
• Gene ID: 11219
• mRNA Refseq: NM_080701
• Protein Refseq: NP_542432
• MIM: 300370
• UniProt ID: Q9BQ50