Recombinant Human TREX2, His-tagged

• Cat.No.: TREX2-30121TH
• Product Overview: Recombinant full length Human TREX2, isoform 2 with an N terminal His tag; 256aa, 28kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 236 amino acids
• Description: This gene encodes a protein with 3 exonuclease activity. Enzymes with this activity are involved in DNA replication, repair, and recombination. Similarity to an E. coli protein suggests that this enzyme may be a subunit of DNA polymerase III, which does not have intrinsic exonuclease activity.
• Conjugation: HIS
• Molecular Weight: 28.000kDa inclusive of tags
• Tissue specificity: Detected in heart, breast, prostate, skeletal muscle, testis, uterus, bone marrow, colon, small intestine, stomach and thymus.
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSEAPRAETFVFLDLEATGLPSVEPEIAELSLFAVHRSSLENPEHDESGALVLPRVLDKLTLCMCPERPFTAKASEITGLSSEGLARCRKAGFDGAVVRTLQAFLSRQAGPICLVAHNGFDYDFPLLCAELRRLGARLPRDTVCLDTLPALRGLDRAHSHGTRARGRQGYSLGSLFHRYFRAEPSAAHSAEGDVHTLLLIFLHRAAELLAWADEQARGWAHIEPMYLPPDDPSLEA
• Sequence Similarities: Belongs to the exonuclease superfamily. TREX family.

Gene Information

• Gene Name: TREX2 three prime repair exonuclease 2 [ Homo sapiens ]
• Official Symbol: TREX2
• Synonyms: TREX2; three prime repair exonuclease 2
• Gene ID: 11219
• mRNA Refseq: NM_080701
• Protein Refseq: NP_542432
• MIM: 300370
• Uniprot ID: Q9BQ50
• Chromosome Location: Xq28
• Function: 3-5-exodeoxyribonuclease activity; exodeoxyribonuclease III activity; exonuclease activity; hydrolase activity; nucleic acid binding