Recombinant Human transgelin Protein, His Tagged

Cat.No. : TAGLN-30925TH
Product Overview : Recombinant Human transgelin protein (1-201 aa) with His tag was expressed in E. coli.
Availability April 18, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-201 aa
Description : This gene encodes a shape change and transformation sensitive actin-binding protein which belongs to the calponin family. It is ubiquitously expressed in vascular and visceral smooth muscle, and is an early marker of smooth muscle differentiation. The encoded protein is thought to be involved in calcium-independent smooth muscle contraction. It acts as a tumor suppressor, and the loss of its expression is an early event in cell transformation and the development of some tumors, coinciding with cellular plasticity. The encoded protein has a domain architecture consisting of an N-terminal calponin homology (CH) domain and a C-terminal calponin-like (CLIK) domain. Mice with a knockout of the orthologous gene are viable and fertile but their vascular smooth muscle cells exhibit alterations in the distribution of the actin filament and changes in cytoskeletal organization.
Molecular Mass : 24 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS
Endotoxin : < 1 EU/μg by LAL.
Purity : > 90 % by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4
Concentration : 1.1 mg/mL by BCA
Gene Name TAGLN transgelin [ Homo sapiens (human) ]
Official Symbol TAGLN
Synonyms TAGLN; transgelin; DKFZp686P11128; SM22; SM22 alpha; SMCC; TAGLN1; transgelin variant 2; WS3 10; SM22-alpha; 22 kDa actin-binding protein; smooth muscle protein 22-alpha; WS3-10; DKFZp686B01212;
Gene ID 6876
mRNA Refseq NM_001001522
Protein Refseq NP_001001522
MIM 600818
UniProt ID Q01995

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TAGLN Products

Required fields are marked with *

My Review for All TAGLN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon