Recombinant Human TRADD, His-tagged

• Cat.No.: TRADD-29977TH
• Product Overview: Recombinant full length protein, corresponding to amino acids 1-150 of Human TRADD with an N terminal His tag; Predicted MWt 17 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 1-150 a.a.
• Description: The protein encoded by this gene is a death domain containing adaptor molecule that interacts with TNFRSF1A/TNFR1 and mediates programmed cell death signaling and NF-kappaB activation. This protein binds adaptor protein TRAF2, reduces the recruitment of inhibitor-of-apoptosis proteins (IAPs) by TRAF2, and thus suppresses TRAF2 mediated apoptosis. This protein can also interact with receptor TNFRSF6/FAS and adaptor protein FADD/MORT1, and is involved in the Fas-induced cell death pathway.
• Conjugation: HIS
• Tissue specificity: Found in all examined tissues.
• Form: Lyophilised:Reconstitute with 113 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVA VYRALQAALAALLAQDPSPVPTLPGPPFPSQGRGHRRL KRVGGSVRGLRAARAPLLPEQWESRLVEAEDLRPLALL CPAGRLPRRLVCPGHTPPFLCFEVPLFCQPSFGA
• Sequence Similarities: Contains 1 death domain.
• Full Length: Full L.

Gene Information

• Gene Name: TRADD TNFRSF1A-associated via death domain [ Homo sapiens ]
• Official Symbol: TRADD
• Synonyms: TRADD; TNFRSF1A-associated via death domain; tumor necrosis factor receptor type 1-associated DEATH domain protein; Hs.89862
• Gene ID: 8717
• mRNA Refseq: NM_003789
• Protein Refseq: NP_003780
• MIM: 603500
• Uniprot ID: Q15628
• Chromosome Location: 16q22
• Pathway: Activation of Pro-Caspase 8, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Apoptosis, organism-specific biosystem; Apoptosis, organism-specific biosystem
• Function: binding, bridging; death domain binding; identical protein binding; kinase binding; protein binding