Recombinant Human TPSB2 Protein (A19-P275), C-6×His-tagged

• Cat.No.: TPSB2-19H
• Product Overview: Recombinant Human TPSB2 Protein (A19-P275) with a C-terminal 6×His tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: A19-P275
• Description: Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes are clustered on chromosome 16p13.3. These genes are characterized by several distinct features. They have a highly conserved 3' UTR and contain tandem repeat sequences at the 5' flank and 3' UTR which are thought to play a role in regulation of the mRNA stability. These genes have an intron immediately upstream of the initiator Met codon, which separates the site of transcription initiation from protein coding sequence. This feature is characteristic of tryptases but is unusual in other genes. The alleles of this gene exhibit an unusual amount of sequence variation, such that the alleles were once thought to represent two separate genes, beta II and beta III. Beta tryptases appear to be the main isoenzymes expressed in mast cells, whereas in basophils, alpha-tryptases predominate. Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic and inflammatory disorders.
• Form: Solution
• Molecular Mass: Approximately 30-35 kDa
• AA Sequence: APAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
• Endotoxin: <1 EU/μg, determined by LAL method.
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Stored at -80 centigrade. It is stable at -20 centigrade for 3 months after opening. It is recommended to freeze aliquots at -80 centigrade for extended storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1.14 mg/mL
• Storage Buffer: Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
• Shipping: Shipping with dry ice.

Gene Information

• Gene Name: TPSB2 tryptase beta 2 [ Homo sapiens (human) ]
• Official Symbol: TPSB2
• Synonyms: TPSB2; tryptase beta 2; TPS2; tryptaseB; tryptaseC; tryptase beta-2; mast cell tryptase beta II; mast cell tryptase beta III; testicular tissue protein Li 163; EC 3.4.21.59
• Gene ID: 64499
• mRNA Refseq: NM_024164
• Protein Refseq: NP_077078
• MIM: 191081
• UniProt ID: P20231