Recombinant Human TPMT protein, GST-tagged
Cat.No. : | TPMT-3612H |
Product Overview : | Recombinant Human TPMT protein(P51580)(4-244aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 4-244aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 54.7 kDa |
AA Sequence : | TRTSLDIEEYSDTEVQKNQVLTLEEWQDKWVNGKTAFHQEQGHQLLKKHLDTFLKGKSGLRVFFPLCGKAVEMKWFADRGHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSIFDLPRTNIGKFDMIWDRGALVAINPGDRKCYADTMFSLLGKKFQYLLCVLSYDPTKHPGPPFYVPHAEIERLFGKICNIRCLEKVDAFEERHKSWGIDCLFEKLYLLTE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TPMT thiopurine S-methyltransferase [ Homo sapiens ] |
Official Symbol | TPMT |
Synonyms | TPMT; thiopurine S-methyltransferase; S-adenosyl-L-methionine:thiopurine S-methyltransferase; |
Gene ID | 7172 |
mRNA Refseq | NM_000367 |
Protein Refseq | NP_000358 |
MIM | 187680 |
UniProt ID | P51580 |
◆ Recombinant Proteins | ||
TPMT-17260M | Recombinant Mouse TPMT Protein | +Inquiry |
TPMT-9540M | Recombinant Mouse TPMT Protein, His (Fc)-Avi-tagged | +Inquiry |
TPMT-30640TH | Recombinant Human TPMT | +Inquiry |
TPMT-5121H | Recombinant Human TPMT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TPMT-6503H | Recombinant Human TPMT Protein (Leu26-His227), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPMT-841HCL | Recombinant Human TPMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TPMT Products
Required fields are marked with *
My Review for All TPMT Products
Required fields are marked with *
0
Inquiry Basket