Recombinant Human TPM3, His-tagged

• Cat.No.: TPM3-30392TH
• Product Overview: Recombinant full length Human Tropomyosin 3 with N terminal His tag; 272 amino acids with tag, Predicted MWt 31.6 kDa.

Specification

• Description: This gene encodes a member of the tropomyosin family of actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosins are dimers of coiled-coil proteins that polymerize end-to-end along the major groove in most actin filaments. They provide stability to the filaments and regulate access of other actin-binding proteins. In muscle cells, they regulate muscle contraction by controlling the binding of myosin heads to the actin filament. Mutations in this gene result in autosomal dominant nemaline myopathy, and oncogenes formed by chromosomal translocations involving this locus are associated with cancer. Multiple transcript variants encoding different isoforms have been found for this gene.
• Protein length: 248 amino acids
• Conjugation: HIS
• Molecular Weight: 31.600kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSHMAGITTIEAVKRKIQV LQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRI QLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIEN RALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVII EGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEE KYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKT IDDLEDKLKCTKEEHLCTQRMLDQTLLDLNEM
• Sequence Similarities: Belongs to the tropomyosin family.

Gene Information

• Gene Name: TPM3 tropomyosin 3 [ Homo sapiens ]
• Official Symbol: TPM3
• Synonyms: TPM3; tropomyosin 3; NEM1; tropomyosin alpha-3 chain; TRK
• Gene ID: 7170
• mRNA Refseq: NM_001043351
• Protein Refseq: NP_001036816
• MIM: 191030
• Uniprot ID: P06753
• Chromosome Location: 1q21.2
• Pathway: Cardiac muscle contraction, organism-specific biosystem; Cardiac muscle contraction, conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem; Hypertrophic cardiomyopathy (HCM), organism-specific biosystem
• Function: actin binding; molecular_function