Recombinant Human TPD52L1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TPD52L1-2086H
• Product Overview: TPD52L1 MS Standard C13 and N15-labeled recombinant protein (NP_001003396) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a member of a family of proteins that contain coiled-coil domains and may form hetero- or homomers. The encoded protein is involved in cell proliferation and calcium signaling. It also interacts with the mitogen-activated protein kinase kinase kinase 5 (MAP3K5/ASK1) and positively regulates MAP3K5-induced apoptosis. Multiple alternatively spliced transcript variants have been observed.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 16.2 kDa
• AA Sequence: MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRRKSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TPD52L1 tumor protein D52-like 1 [ Homo sapiens (human) ]
• Official Symbol: TPD52L1
• Synonyms: TPD52L1; tumor protein D52-like 1; tumor protein D53; D53; hD53; MGC8556
• Gene ID: 7164
• mRNA Refseq: NM_001003396
• Protein Refseq: NP_001003396
• MIM: 604069
• UniProt ID: Q16890