Recombinant Human TNPO2 protein, His-tagged

• Cat.No.: TNPO2-3338H
• Product Overview: Recombinant Human TNPO2 protein(O14787)(Ala271-Asp360), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: Ala271-Asp360
• Form: 0.15 M Phosphate buffered saline, pH 7.4.
• AASequence: ALEACEFWLTLAEQPICKEVLASHLVQLIPILVNGMKYSEIDIILLKGDVEEDEAVPDSEQDIKPRFHKSRTVTLPHEAERPDGSEDAED
• Storage: Samples are stable for up to twelve months from date of receipt at -20°C to -80°C. Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: TNPO2 transportin 2 [ Homo sapiens ]
• Official Symbol: TNPO2
• Synonyms: TNPO2; transportin 2; transportin-2; FLJ12155; importin 3; IPO3; karyopherin beta 2b; KPNB2B; TRN2; karyopherin beta-2b; karyopherin beta 2b, transportin; transportin 2 (importin 3, karyopherin beta 2b)
• Gene ID: 30000
• mRNA Refseq: NM_001136195
• Protein Refseq: NP_001129667
• MIM: 603002
• UniProt ID: O14787