Recombinant Human TNPO2 Protein, 201-300, N-GST tagged

Cat.No. : TNPO2-06H
Product Overview : Human TNPO2 partial ORF ( NP_038461, 201 a.a. - 300 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro).
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 201-300
Description : Predicted to enable nuclear import signal receptor activity and nuclear localization sequence binding activity. Predicted to be involved in protein import into nucleus. Predicted to act upstream of or within negative regulation of muscle cell differentiation. Predicted to be active in cytoplasm and nucleus.
Molecular Mass : 36.74 kDa
AA Sequence : MDRAQALMDNIDTFIEHLFALAVDDDPEVRKNVCRALVMLLEVRIDRLIPHMHSIIQYMLQRTQDHDENVALEACEFWLTLAEQPICKEVLASHLVQLIP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TNPO2 transportin 2 [ Homo sapiens (human) ]
Official Symbol TNPO2
Synonyms TNPO2; transportin 2; transportin-2; FLJ12155; importin 3; IPO3; karyopherin beta 2b; KPNB2B; TRN2; karyopherin beta-2b; karyopherin beta 2b, transportin; transportin 2 (importin 3, karyopherin beta 2b)
Gene ID 30000
mRNA Refseq NM_013433
Protein Refseq NP_038461
MIM 603002
UniProt ID B4DRY5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TNPO2 Products

Required fields are marked with *

My Review for All TNPO2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon