Recombinant Human TNKS protein, GST-tagged

• Cat.No.: TNKS-3328H
• Product Overview: Recombinant Human TNKS(1017 a.a. - 1124 a.a.), fussed with GST at N-terminal, was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• ProteinLength: 1017 a.a. - 1124 a.a.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 37.62 kDa
• AA Sequence: TERKEGEVAGLDMNISQFLKSLGLEHLRDIFETEQITLDVLADMGHEELKEIGINAYGHRHKLIKGVERLLGGQQ GTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEE
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: TNKS tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase [ Homo sapiens ]
• Official Symbol: TNKS
• Synonyms: TNKS; tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase; tankyrase-1; PARP 5a; PARP5A; pART5; TIN1; TINF1; TNKS1; TANK1; TNKS-1; tankyrase I; poly [ADP-ribose] polymerase 5A; TRF1-interacting ankyrin-related ADP-ribose polymerase; PARPL; PARP-5a
• Gene ID: 8658
• mRNA Refseq: NM_003747
• Protein Refseq: NP_003738
• MIM: 603303
• UniProt ID: O95271
• Chromosome Location: 8p23.1
• Pathway: Regulation of Telomerase, organism-specific biosystem
• Function: NAD+ ADP-ribosyltransferase activity; metal ion binding; protein binding; transferase activity, transferring glycosyl groups; zinc ion binding