Recombinant Human TNFSF15 Protein, Biotinylated

• Cat.No.: TNFSF15-01H
• Product Overview: A DNA sequence encoding the human TL1A (Qln58-Leu251) with a polyhistidine tag and AviTag™ peptide at the N-terminus was expressed in E. coli and biotinylated at AviTag™. Based on the size-exclusion chromatography data, the purified protein elutes as a trimer.

Specification

• Description: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of this protein is inducible by TNF and IL-1 alpha. This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells. This cytokine is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor. Two transcript variants encoding different isoforms have been found for this gene.
• Source: Escherichia coli
• Species: Human
• Tag: His&Avi
• Molecular Mass: ~25 kDa (monomer)
• AA Sequence: MHHHHHHGSGLNDIFEAQKIEWHEGGSQLRAQGEASVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
• Purity: >90% by Coomassie staining
• Usage: This product is for laboratory research use only.
• Storage: Storage is recommended at -80°C for longer periods of time.
• Storage Buffer: 20 mM Phosphate buffer, pH 7.4, 120 mM NaCl, 5 mM 2-mercaptoethanol, and 10% glycerol.
• Shipping: Product requires shipping on ice packs.
• Protein length: 58-251 a.a.

Gene Information

• Gene Name: TNFSF15 TNF superfamily member 15 [ Homo sapiens (human) ]
• Official Symbol: TNFSF15
• Synonyms: TL1; TL1A; VEGI; TNLG1B; VEGI192A
• Gene ID: 9966
• mRNA Refseq: NM_001204344.1
• Protein Refseq: NP_001191273.1
• MIM: 604052
• UniProt ID: O95150