Recombinant Human TNFSF15, His-tagged

• Cat.No.: TNFSF15-31532TH
• Product Overview: Recombinant full length Human TL1A, secreted form with an N terminal His tag; 201 amino acids, Predicted MWt 22.7kDa.

Specification

• Description: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of this protein is inducible by TNF and IL-1 alpha. This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells. This cytokine is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor. Two transcript variants encoding different isoforms have been found for this gene.
• Protein length: 180 amino acids
• Conjugation: HIS
• Molecular Weight: 22.700kDa inclusive of tags
• Source: E. coli
• Tissue specificity: Specifically expressed in endothelial cells. Detected in monocytes, placenta, lung, liver, kidney, skeletal muscle, pancreas, spleen, prostate, small intestine and colon.
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 50% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMLKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
• Sequence Similarities: Belongs to the tumor necrosis factor family.

Gene Information

• Gene Name: TNFSF15 tumor necrosis factor (ligand) superfamily, member 15 [ Homo sapiens ]
• Official Symbol: TNFSF15
• Synonyms: TNFSF15; tumor necrosis factor (ligand) superfamily, member 15; tumor necrosis factor ligand superfamily member 15; MGC129934; MGC129935; TL1; TL1A; TNF ligand related molecule 1; TNF superfamily ligand TL1A; vascular endothelial cell growth inhibitor; va
• Gene ID: 9966
• mRNA Refseq: NM_005118
• Protein Refseq: NP_005109
• MIM: 604052
• Uniprot ID: O95150
• Chromosome Location: 9q32
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Senescence and Autophagy, organism-specific biosystem
• Function: cytokine activity; death receptor binding; receptor binding; tumor necrosis factor receptor binding