Recombinant Human TNFSF12 Protein, His/FLAG-tagged

• Cat.No.: TNFSF12-01H
• Product Overview: Recombinant Human TNFSF12 (A106-H249) Protein fused with His/FLAG tag.

Specification

• Description: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is a ligand for the FN14/TWEAKR receptor. This cytokine has overlapping signaling functions with TNF, but displays a much wider tissue distribution. This cytokine, which exists in both membrane-bound and secreted forms, can induce apoptosis via multiple pathways of cell death in a cell type-specific manner. This cytokine is also found to promote proliferation and migration of endothelial cells, and thus acts as a regulator of angiogenesis. Alternative splicing results in multiple transcript variants.
• Source: HEK293T
• Species: Human
• Tag: His&Flag
• Molecular Mass: 20 kDa
• Protein length: A106-H249
• AA Sequence: DVHHHHHHDYKDDDDKLKDPAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPIRYNRQIGEFIVTRAGLYYYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGTALRPGSSIRIRTLPWAHLKAAPFLTYFGLFQVH
• Purity: 95%

Gene Information

• Gene Name: TNFSF12 TNF superfamily member 12 [ Homo sapiens (human) ]
• Official Symbol: TNFSF12
• Synonyms: TNFSF12; TNF superfamily member 12; APO3L; DR3LG; TWEAK; TNLG4A; tumor necrosis factor ligand superfamily member 12; APO3 ligand; APO3/DR3 ligand; TNF-related WEAK inducer of apoptosis; tumor necrosis factor (ligand) superfamily, member 12; tumor necrosis factor ligand 4A; tumor necrosis factor superfamily member 12
• Gene ID: 8742
• mRNA Refseq: NM_003809
• Protein Refseq: NP_003800
• MIM: 602695
• UniProt ID: O43508