Recombinant Human TNFRSF13B protein

• Cat.No.: TNFRSF13B-970H
• Product Overview: Recombinant Human TNFRSF13B protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 160
• Description: The protein encoded by this gene is a lymphocyte-specific member of the tumor necrosis factor (TNF) receptor superfamily. It interacts with calcium-modulator and cyclophilin ligand (CAML). The protein induces activation of the transcription factors NFAT, AP1, and NF-kappa-B and plays a crucial role in humoral immunity by interacting with a TNF ligand. This gene is located within the Smith-Magenis syndrome region on chromosome 17.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The biological activity is determined by its ability to block human BAFF induced T2B cell survival using a concentration range of 1.0-3.0 µg/ml.
• Molecular Mass: Approximately 18.0 kDa, a single non-glycosylated polypeptide chain containing 160 amino acids.
• AA Sequence: MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQV
• Endotoxin: Less than 1 EU/μg of rHuTACI/TNFRSF13B as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: TNFRSF13B
• Official Symbol: TNFRSF13B
• Synonyms: TNFRSF13B; tumor necrosis factor receptor superfamily, member 13B; tumor necrosis factor receptor superfamily member 13B; CD267; TACI; tumor necrosis factor receptor 13B; transmembrane activator and CAML interactor; CVID; CVID2; TNFRSF14B; FLJ39942; MGC39952; MGC133214
• Gene ID: 23495
• mRNA Refseq: NM_012452
• Protein Refseq: NP_036584
• MIM: 604907
• UniProt ID: O14836