Recombinant Human TNFRSF11B Protein

• Cat.No.: TNFRSF11B-829H
• Product Overview: Recombinant human TNFRSF11B protein without tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• ProteinLength: 401
• Description: The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is an osteoblast-secreted decoy receptor that functions as a negative regulator of bone resorption. This protein specifically binds to its ligand, osteoprotegerin ligand, both of which are key extracellular regulators of osteoclast development. Studies of the mouse counterpart also suggest that this protein and its ligand play a role in lymph-node organogenesis and vascular calcification. Alternatively spliced transcript variants of this gene have been reported, but their full length nature has not been determined.
• Form: Lyophilized
• Molecular Mass: 44.4 kDa
• AA Sequence: MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
• Purity: > 98%
• Applications: Migration Assay
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: TNFRSF11B tumor necrosis factor receptor superfamily, member 11b [ Homo sapiens (human) ]
• Official Symbol: TNFRSF11B
• Synonyms: TNFRSF11B; tumor necrosis factor receptor superfamily, member 11b; OPG, osteoprotegerin; tumor necrosis factor receptor superfamily member 11B; OCIF; TR1; osteoprotegerin; osteoclastogenesis inhibitory factor; OPG; MGC29565
• Gene ID: 4982
• mRNA Refseq: NM_002546
• Protein Refseq: NP_002537
• MIM: 602643
• UniProt ID: O00300