Recombinant Human TNFRSF11A protein, GST-tagged

Cat.No. : TNFRSF11A-301530H
Product Overview : Recombinant Human TNFRSF11A (33-205 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Pro33-Asn205
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : PCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPN
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator [ Homo sapiens ]
Official Symbol TNFRSF11A
Synonyms TNFRSF11A; tumor necrosis factor receptor superfamily, member 11a, NFKB activator; tumor necrosis factor receptor superfamily, member 11a, activator of NFKB; tumor necrosis factor receptor superfamily member 11A; CD265; RANK; receptor activator of NF-KB; osteoclast differentiation factor receptor; receptor activator of nuclear factor-kappa B; loss of heterozygosity, 18, chromosomal region 1; FEO; OFE; ODFR; OSTS; PDB2; OPTB7; TRANCER; LOH18CR1;
Gene ID 8792
mRNA Refseq NM_003839
Protein Refseq NP_003830
MIM 603499
UniProt ID Q9Y6Q6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TNFRSF11A Products

Required fields are marked with *

My Review for All TNFRSF11A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon