Recombinant Human TNFRSF11A Protein, His-tagged

• Cat.No.: TNFRSF11A-155H
• Product Overview: Recombinant Human TNFRSF11A Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: RANK (receptor activator of NF-κB) is a member of the tumor necrosis factor (TNF) receptor subfamily that is activated by its ligand, RANKL (TRANCE/OPGL/ODF), to promote survival of dendritic cells and differentiation of osteoclasts. Although RANK is widely expressed, its cell surface expression may be more restricted to dendritic cells and foreskin fibroblasts. RANK contains a 383-amino acid intracellular domain that associates with specific members of the TRAF family to NF-κB and JNK activiation. RANKL/RANK signaling may also lead to survival signaling through activation of the Akt pathway and an upregulation of survival proteins, including Bcl-xL. RANK signaling has been implicated as a potential therapeutic to inhibit bone loss and arthritis.
• Molecular Mass: ~21 kDa
• AA Sequence: MIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLP
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator [ Homo sapiens (human) ]
• Official Symbol: TNFRSF11A
• Synonyms: TNFRSF11A; tumor necrosis factor receptor superfamily, member 11a, NFKB activator; tumor necrosis factor receptor superfamily, member 11a, activator of NFKB; tumor necrosis factor receptor superfamily member 11A; CD265; RANK; receptor activator of NF-KB; osteoclast differentiation factor receptor; receptor activator of nuclear factor-kappa B; loss of heterozygosity, 18, chromosomal region 1; FEO; OFE; ODFR; OSTS; PDB2; OPTB7; TRANCER; LOH18CR1
• Gene ID: 8792
• mRNA Refseq: NM_003839
• Protein Refseq: NP_003830
• MIM: 603499
• UniProt ID: Q9Y6Q6