Recombinant Human TNFRSF11A Protein, His-tagged
Cat.No. : | TNFRSF11A-155H |
Product Overview : | Recombinant Human TNFRSF11A Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | RANK (receptor activator of NF-κB) is a member of the tumor necrosis factor (TNF) receptor subfamily that is activated by its ligand, RANKL (TRANCE/OPGL/ODF), to promote survival of dendritic cells and differentiation of osteoclasts. Although RANK is widely expressed, its cell surface expression may be more restricted to dendritic cells and foreskin fibroblasts. RANK contains a 383-amino acid intracellular domain that associates with specific members of the TRAF family to NF-κB and JNK activiation. RANKL/RANK signaling may also lead to survival signaling through activation of the Akt pathway and an upregulation of survival proteins, including Bcl-xL. RANK signaling has been implicated as a potential therapeutic to inhibit bone loss and arthritis. |
Molecular Mass : | ~21 kDa |
AA Sequence : | MIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLP |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator [ Homo sapiens (human) ] |
Official Symbol | TNFRSF11A |
Synonyms | TNFRSF11A; tumor necrosis factor receptor superfamily, member 11a, NFKB activator; tumor necrosis factor receptor superfamily, member 11a, activator of NFKB; tumor necrosis factor receptor superfamily member 11A; CD265; RANK; receptor activator of NF-KB; osteoclast differentiation factor receptor; receptor activator of nuclear factor-kappa B; loss of heterozygosity, 18, chromosomal region 1; FEO; OFE; ODFR; OSTS; PDB2; OPTB7; TRANCER; LOH18CR1; |
Gene ID | 8792 |
mRNA Refseq | NM_003839 |
Protein Refseq | NP_003830 |
MIM | 603499 |
UniProt ID | Q9Y6Q6 |
◆ Recombinant Proteins | ||
TNFRSF11A-392H | Active Recombinant Human TNFRSF11A protein, mFc-tagged | +Inquiry |
TNFRSF11A-40H | Recombinant Human TNFRSF11A Protein, hIgG-His-tagged | +Inquiry |
TNFRSF11A-1644R | Recombinant Rhesus Monkey TNFRSF11A Protein, hIgG4-tagged | +Inquiry |
Tnfrsf11a-186R | Recombinant Rat Tnfrsf11a Protein, His-tagged | +Inquiry |
TNFRSF11A-1084R | Recombinant Rat TNFRSF11A Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF11A-1413RCL | Recombinant Rat TNFRSF11A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF11A Products
Required fields are marked with *
My Review for All TNFRSF11A Products
Required fields are marked with *
0
Inquiry Basket