Recombinant Human TNFRSF10B, Fc-tagged

• Cat.No.: TNFRSF10B-28127TH
• Product Overview: Recombinant fragment corresponding to amino acids 56-182 of Human DR5 fused to the Fc region of human IgG1 expressed in modified human 293 cells, 40-50kDa.

Specification

• Species: Human
• Tag: Fc
• Protein Length: 56-182 a.a.
• Description: The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. Two transcript variants encoding different isoforms and one non-coding transcript have been found for this gene.
• Conjugation: Fc
• Tissue specificity: Widely expressed in adult and fetal tissues; very highly expressed in tumor cell lines such as HeLa S3, K562, HL-60, SW480, A549 and G361; highly expressed in heart, peripheral blood lymphocytes, liver, pancreas, spleen, thymus, prostate, ovary, uterus, p
• Biological activity: The ED50 of DR5 Fc Chimera is typically 38-40 ng/ml as measured by its ability to neutralize TRAIL mediated cytotoxicity using the human leukemic Jurkat cells.
• Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
• Storage: Shipped at 4°C. After reconstitution store at -20oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: Theoretical sequence:ITQQDLAPQQRAAPQQKRSSPSEGLCPPG HHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSG EVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGC PRGMVKVGDCTPWSDIECVHKEGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Sequence Similarities: Contains 1 death domain.Contains 3 TNFR-Cys repeats.

Gene Information

• Gene Name: TNFRSF10B tumor necrosis factor receptor superfamily, member 10b [ Homo sapiens ]
• Official Symbol: TNFRSF10B
• Synonyms: TNFRSF10B; tumor necrosis factor receptor superfamily, member 10b; tumor necrosis factor receptor superfamily member 10B; CD262; DR5; KILLER; TRAIL R2; TRICK2A; TRICKB
• Gene ID: 8795
• mRNA Refseq: NM_003842
• Protein Refseq: NP_003833
• MIM: 603612
• Uniprot ID: O14763
• Chromosome Location: 8p22-p21
• Pathway: Activation of Pro-Caspase 8, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Apoptosis, organism-specific biosystem
• Function: TRAIL binding; cysteine-type endopeptidase activator activity involved in apoptotic process; protein binding; receptor activity