Recombinant Human TNFAIP8 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TNFAIP8-3981H |
Product Overview : | TNFAIP8 MS Standard C13 and N15-labeled recombinant protein (NP_001071122) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation. |
Source : | HEK293 |
Species : | Human |
Tag : | Myc&DDK |
Molecular Mass : | 21.7 kDa |
AA Sequence : | MATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TNFAIP8 TNF alpha induced protein 8 [ Homo sapiens (human) ] |
Official Symbol | TNFAIP8 |
Synonyms | TNFAIP8; tumor necrosis factor, alpha-induced protein 8; tumor necrosis factor alpha-induced protein 8; GG2 1; MDC 3.13; SCC S2; NDED; TNF-induced protein GG2-1; TNF alpha-induced protein 8; NF-kappa-B-inducible DED-containing protein; head and neck tumor and metastasis-related protein; GG2-1; SCCS2; SCC-S2; MDC-3.13; |
Gene ID | 25816 |
mRNA Refseq | NM_001077654 |
Protein Refseq | NP_001071122 |
MIM | 612111 |
UniProt ID | O95379 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TNFAIP8 Products
Required fields are marked with *
My Review for All TNFAIP8 Products
Required fields are marked with *
0
Inquiry Basket