Recombinant Human TNFAIP8 protein, GST-tagged

• Cat.No.: TNFAIP8-3620H
• Product Overview: Recombinant Human TNFAIP8 protein(1-198 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-198 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: TNFAIP8 tumor necrosis factor, alpha-induced protein 8 [ Homo sapiens ]
• Official Symbol: TNFAIP8
• Synonyms: TNFAIP8; tumor necrosis factor, alpha-induced protein 8; tumor necrosis factor alpha-induced protein 8; GG2 1; MDC 3.13; SCC S2; NDED; TNF-induced protein GG2-1; TNF alpha-induced protein 8; NF-kappa-B-inducible DED-containing protein; head and neck tumor and metastasis-related protein; GG2-1; SCCS2; SCC-S2; MDC-3.13
• Gene ID: 25816
• mRNA Refseq: NM_001077654
• Protein Refseq: NP_001071122
• MIM: 612111
• UniProt ID: O95379