Recombinant Human TNC Partial Protein, His-tagged

• Cat.No.: TNC-32H
• Product Overview: Recombinant Human TNC Partial Protein (1888-2201 aa) with a N-terminal 6xHis tag was expressed in E. coli.

Specification

• Description: This gene encodes an extracellular matrix protein with a spatially and temporally restricted tissue distribution. This protein is homohexameric with disulfide-linked subunits, and contains multiple EGF-like and fibronectin type-III domains. It is implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity, and neuronal regeneration.
• Source: E. coli
• Species: Human
• Tag: His
• Form: Liquid or Lyophilized powder
• Molecular Mass: 39.5 kDa
• Protein length: 1888-2201
• AA Sequence: DSPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA
• Purity: > 90 % as determined by SDS-PAGE.
• Stability: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
  Generally, the shelf life of liquid form is 6 months at -20/-80 centigrade. The shelf life of lyophilized form is 12 months at -20/-80 centigrade.
• Storage: Store at -20 centigrade/-80 centigrade upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5 %-50 % glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6 % Trehalose, pH 8.0.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50 % of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50 %. Customers could use it as reference.

Gene Information

• Gene Name: TNC tenascin C [ Homo sapiens (human) ]
• Official Symbol: TNC
• Synonyms: TNC; tenascin C; GP; JI; TN; HXB; GMEM; TN-C; DFNA56; 150-225; tenascin; GP 150-225; cytotactin; deafness, autosomal dominant 56; glioma-associated-extracellular matrix antigen; hexabrachion (tenascin); myotendinous antigen; neuronectin; tenascin-C additional domain 1
• Gene ID: 3371
• mRNA Refseq: NM_002160
• Protein Refseq: NP_002151
• MIM: 187380
• UniProt ID: P24821