Recombinant Human TNC Partial Protein, His-tagged
Cat.No. : | TNC-32H |
Product Overview : | Recombinant Human TNC Partial Protein (1888-2201 aa) with a N-terminal 6xHis tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1888-2201 |
Description : | This gene encodes an extracellular matrix protein with a spatially and temporally restricted tissue distribution. This protein is homohexameric with disulfide-linked subunits, and contains multiple EGF-like and fibronectin type-III domains. It is implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity, and neuronal regeneration. |
Form : | Liquid or Lyophilized powder |
Molecular Mass : | 39.5 kDa |
AA Sequence : | DSPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA |
Purity : | > 90 % as determined by SDS-PAGE. |
Stability : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20/-80 centigrade. The shelf life of lyophilized form is 12 months at -20/-80 centigrade. |
Storage : | Store at -20 centigrade/-80 centigrade upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5 %-50 % glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6 % Trehalose, pH 8.0. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50 % of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50 %. Customers could use it as reference. |
Gene Name | TNC tenascin C [ Homo sapiens (human) ] |
Official Symbol | TNC |
Synonyms | TNC; tenascin C; GP; JI; TN; HXB; GMEM; TN-C; DFNA56; 150-225; tenascin; GP 150-225; cytotactin; deafness, autosomal dominant 56; glioma-associated-extracellular matrix antigen; hexabrachion (tenascin); myotendinous antigen; neuronectin; tenascin-C additional domain 1 |
Gene ID | 3371 |
mRNA Refseq | NM_002160 |
Protein Refseq | NP_002151 |
MIM | 187380 |
UniProt ID | P24821 |
◆ Recombinant Proteins | ||
TNC-995HFL | Recombinant Full Length Human TNC Protein, C-Flag-tagged | +Inquiry |
Tnc-2326M | Recombinant Mouse Tnc protein, His&Myc-tagged | +Inquiry |
TNC-31215TH | Recombinant Human TNC | +Inquiry |
TNC-1082H | Recombinant Human TNC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TNC-735H | Recombinant Human TNC protein(Gly23-Ser621), His-tagged | +Inquiry |
◆ Native Proteins | ||
TNC-50H | Native Human Tenascin C | +Inquiry |
TNC-08H | Native Human TNC Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNC Products
Required fields are marked with *
My Review for All TNC Products
Required fields are marked with *
0
Inquiry Basket