Recombinant Human TMX1 protein, GST-tagged

Cat.No. : TMX1-301370H
Product Overview : Recombinant Human TMX1 (202-280 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Val202-Ser280
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : VADCLCPSKRRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name TMX1 thioredoxin-related transmembrane protein 1 [ Homo sapiens ]
Official Symbol TMX1
Synonyms TMX1; thioredoxin-related transmembrane protein 1; thioredoxin domain containing , thioredoxin domain containing 1 , thioredoxin domain containing , TXNDC, TXNDC1; PDIA11; protein disulfide isomerase family A; member 11; thioredoxin related transmembrane protein; TMX; thioredoxin domain containing 1; transmembrane Trx-related protein; thioredoxin domain-containing protein 1; protein disulfide isomerase family A, member 11; TXNDC; TXNDC1; DKFZp564E1962;
Gene ID 81542
mRNA Refseq NM_030755
Protein Refseq NP_110382
MIM 610527
UniProt ID Q9H3N1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TMX1 Products

Required fields are marked with *

My Review for All TMX1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon