Recombinant Human TMX1 protein, GST-tagged

• Cat.No.: TMX1-301370H
• Product Overview: Recombinant Human TMX1 (202-280 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Val202-Ser280
• AA Sequence: VADCLCPSKRRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: TMX1 thioredoxin-related transmembrane protein 1 [ Homo sapiens ]
• Official Symbol: TMX1
• Synonyms: TMX1; thioredoxin-related transmembrane protein 1; thioredoxin domain containing , thioredoxin domain containing 1 , thioredoxin domain containing , TXNDC, TXNDC1; PDIA11; protein disulfide isomerase family A; member 11; thioredoxin related transmembrane protein; TMX; thioredoxin domain containing 1; transmembrane Trx-related protein; thioredoxin domain-containing protein 1; protein disulfide isomerase family A, member 11; TXNDC; TXNDC1; DKFZp564E1962
• Gene ID: 81542
• mRNA Refseq: NM_030755
• Protein Refseq: NP_110382
• MIM: 610527
• UniProt ID: Q9H3N1