Recombinant Human TMEM14B Protein (1-114 aa), GST-tagged
Cat.No. : | TMEM14B-836H |
Product Overview : | Recombinant Human TMEM14B Protein (1-114 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-114 aa |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 39.1 kDa |
AA Sequence : | MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGSVPSLAAGLLFGSLAGLGAYQLYQDPRNVWGFLAATSVTFVGVMGMRSYYYGKFMPVGLIAGASLLMAAKVGVRMLMTSD |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | TMEM14B transmembrane protein 14B [ Homo sapiens ] |
Official Symbol | TMEM14B |
Synonyms | TMEM14B; transmembrane protein 14B; MGC1223; FLJ60468; |
Gene ID | 81853 |
mRNA Refseq | NM_001127711 |
Protein Refseq | NP_001121183 |
UniProt ID | Q9NUH8 |
◆ Recombinant Proteins | ||
TMEM14B-740H | Recombinant Human TMEM14B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TMEM14B-283H | Recombinant Human TMEM14B Protein, MYC/DDK-tagged | +Inquiry |
RFL14824HF | Recombinant Full Length Human Transmembrane Protein 14B(Tmem14B) Protein, His-Tagged | +Inquiry |
TMEM14B-836H | Recombinant Human TMEM14B Protein (1-114 aa), GST-tagged | +Inquiry |
TMEM14B-4775R | Recombinant Rhesus monkey TMEM14B Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM14B-998HCL | Recombinant Human TMEM14B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM14B Products
Required fields are marked with *
My Review for All TMEM14B Products
Required fields are marked with *
0
Inquiry Basket