Recombinant Human TMEM14B Protein (1-114 aa), GST-tagged

• Cat.No.: TMEM14B-836H
• Product Overview: Recombinant Human TMEM14B Protein (1-114 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 39.1 kDa
• Protein length: 1-114 aa
• AA Sequence: MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGSVPSLAAGLLFGSLAGLGAYQLYQDPRNVWGFLAATSVTFVGVMGMRSYYYGKFMPVGLIAGASLLMAAKVGVRMLMTSD
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: TMEM14B transmembrane protein 14B [ Homo sapiens ]
• Official Symbol: TMEM14B
• Synonyms: TMEM14B; transmembrane protein 14B; MGC1223; FLJ60468
• Gene ID: 81853
• mRNA Refseq: NM_001127711
• Protein Refseq: NP_001121183
• UniProt ID: Q9NUH8