Recombinant Human TMEM14B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TMEM14B-740H |
Product Overview : | TMEM14B MS Standard C13 and N15-labeled recombinant protein (NP_112231) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Primate-specific protein involved in cortical expansion and folding in the developing neocortex. May drive neural progenitor proliferation through nuclear translocation of IQGAP1, which in turn promotes G1/S cell cycle transitions. |
Molecular Mass : | 12.2 kDa |
AA Sequence : | MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGSVPSLAAWLLFGSLAGLGAYQLYQDPRNVWGFLAATSVTFVGVMGMRSYYYGKFMPVGLIAGASLLMAAKVGVRMLMTSDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TMEM14B transmembrane protein 14B [ Homo sapiens (human) ] |
Official Symbol | TMEM14B |
Synonyms | TMEM14B; transmembrane protein 14B; MGC1223; FLJ60468; |
Gene ID | 81853 |
mRNA Refseq | NM_030969 |
Protein Refseq | NP_112231 |
UniProt ID | Q9NUH8 |
◆ Recombinant Proteins | ||
TMEM14B-283H | Recombinant Human TMEM14B Protein, MYC/DDK-tagged | +Inquiry |
RFL14824HF | Recombinant Full Length Human Transmembrane Protein 14B(Tmem14B) Protein, His-Tagged | +Inquiry |
TMEM14B-4775R | Recombinant Rhesus monkey TMEM14B Protein, His-tagged | +Inquiry |
TMEM14B-740H | Recombinant Human TMEM14B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TMEM14B-4589R | Recombinant Rhesus Macaque TMEM14B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM14B-998HCL | Recombinant Human TMEM14B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM14B Products
Required fields are marked with *
My Review for All TMEM14B Products
Required fields are marked with *
0
Inquiry Basket