Recombinant Human TMEM14B Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TMEM14B-740H
• Product Overview: TMEM14B MS Standard C13 and N15-labeled recombinant protein (NP_112231) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Primate-specific protein involved in cortical expansion and folding in the developing neocortex. May drive neural progenitor proliferation through nuclear translocation of IQGAP1, which in turn promotes G1/S cell cycle transitions.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 12.2 kDa
• AA Sequence: MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGSVPSLAAWLLFGSLAGLGAYQLYQDPRNVWGFLAATSVTFVGVMGMRSYYYGKFMPVGLIAGASLLMAAKVGVRMLMTSDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TMEM14B transmembrane protein 14B [ Homo sapiens (human) ]
• Official Symbol: TMEM14B
• Synonyms: TMEM14B; transmembrane protein 14B; MGC1223; FLJ60468
• Gene ID: 81853
• mRNA Refseq: NM_030969
• Protein Refseq: NP_112231
• UniProt ID: Q9NUH8