Recombinant Human TMEM141 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TMEM141-3258H
• Product Overview: TMEM141 MS Standard C13 and N15-labeled recombinant protein (NP_116317) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: TMEM141 (Transmembrane Protein 141) is a Protein Coding gene. Diseases associated with TMEM141 include Intraneural Perineurioma. An important paralog of this gene is CCDC151.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 11.9 kDa
• AA Sequence: MVNLGLSRVDDAVAAKHPGLGEYAACQSHAFMKGVFTFVTGTGMAFGLQMFIQRKFPYPLQWSLLVAVVAGSVVSYGVTRVESEKCNNLWLFLETGQLPKDRSTDQRSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TMEM141 transmembrane protein 141 [ Homo sapiens (human) ]
• Official Symbol: TMEM141
• Synonyms: TMEM141; transmembrane protein 141; MGC14141; RP11-216L13.7
• Gene ID: 85014
• mRNA Refseq: NM_032928
• Protein Refseq: NP_116317
• UniProt ID: Q96I45