Recombinant Human TMEM141 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TMEM141-3258H
Product Overview : TMEM141 MS Standard C13 and N15-labeled recombinant protein (NP_116317) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : TMEM141 (Transmembrane Protein 141) is a Protein Coding gene. Diseases associated with TMEM141 include Intraneural Perineurioma. An important paralog of this gene is CCDC151.
Molecular Mass : 11.9 kDa
AA Sequence : MVNLGLSRVDDAVAAKHPGLGEYAACQSHAFMKGVFTFVTGTGMAFGLQMFIQRKFPYPLQWSLLVAVVAGSVVSYGVTRVESEKCNNLWLFLETGQLPKDRSTDQRSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TMEM141 transmembrane protein 141 [ Homo sapiens (human) ]
Official Symbol TMEM141
Synonyms TMEM141; transmembrane protein 141; MGC14141; RP11-216L13.7;
Gene ID 85014
mRNA Refseq NM_032928
Protein Refseq NP_116317
UniProt ID Q96I45

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TMEM141 Products

Required fields are marked with *

My Review for All TMEM141 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon