Recombinant Full Length Danio Rerio Transmembrane Protein 141(Tmem141) Protein, His-Tagged
Cat.No. : | RFL28074DF |
Product Overview : | Recombinant Full Length Danio rerio Transmembrane protein 141(tmem141) Protein (Q0D285) (1-124aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-124) |
Form : | Lyophilized powder |
AA Sequence : | MVNIGLSKVDDAIVAKHPGLQQYVACQSYAFMKGTASFILGTVGIFFGQRALQKIIKYPL QWNLFVSIVSSSVFSYSVTRWETMKCSDVWLFLETGNIPDRNSDKEEPETSADSTTTQHE DVLE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tmem141 |
Synonyms | tmem141; zgc:153677; Transmembrane protein 141 |
UniProt ID | Q0D285 |
◆ Recombinant Proteins | ||
RFL28074DF | Recombinant Full Length Danio Rerio Transmembrane Protein 141(Tmem141) Protein, His-Tagged | +Inquiry |
TMEM141-835H | Recombinant Human TMEM141 Protein (1-108 aa), GST-tagged | +Inquiry |
Tmem141-6476M | Recombinant Mouse Tmem141 Protein, Myc/DDK-tagged | +Inquiry |
TMEM141-9300M | Recombinant Mouse TMEM141 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL6717MF | Recombinant Full Length Mouse Transmembrane Protein 141(Tmem141) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM141-1001HCL | Recombinant Human TMEM141 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All tmem141 Products
Required fields are marked with *
My Review for All tmem141 Products
Required fields are marked with *
0
Inquiry Basket