Recombinant Human TMEM134 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TMEM134-6601H
• Product Overview: TMEM134 MS Standard C13 and N15-labeled recombinant protein (NP_079400) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: TMEM134 (Transmembrane Protein 134) is a Protein Coding gene. Diseases associated with TMEM134 include Hepatitis E and Hypopyon.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 21.4 kDa
• AA Sequence: MSAARPQFSIDDAFELSLEDGGPGPESSGVARFGPLHFERRARFEVADEDKQSRLRYQNLENDEDGAQASPEPDGGVGTRDSSRTSIRSSQWSFSTISSSTQRSYNTCCSWTQHPLIQKNRRVVLASFLLLLLGLVLILVGVGLEATPSPGVSSAIFFVPGFLLLVPGVYHVIFIYCAVKGHRGFQFFYLPYFEKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TMEM134 transmembrane protein 134 [ Homo sapiens (human) ]
• Official Symbol: TMEM134
• Synonyms: TMEM134; transmembrane protein 134; transmembrane protein 134
• Gene ID: 80194
• mRNA Refseq: NM_025124
• Protein Refseq: NP_079400
• UniProt ID: Q9H6X4