Recombinant Human TMEM134 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TMEM134-6601H
Product Overview : TMEM134 MS Standard C13 and N15-labeled recombinant protein (NP_079400) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : TMEM134 (Transmembrane Protein 134) is a Protein Coding gene. Diseases associated with TMEM134 include Hepatitis E and Hypopyon.
Molecular Mass : 21.4 kDa
AA Sequence : MSAARPQFSIDDAFELSLEDGGPGPESSGVARFGPLHFERRARFEVADEDKQSRLRYQNLENDEDGAQASPEPDGGVGTRDSSRTSIRSSQWSFSTISSSTQRSYNTCCSWTQHPLIQKNRRVVLASFLLLLLGLVLILVGVGLEATPSPGVSSAIFFVPGFLLLVPGVYHVIFIYCAVKGHRGFQFFYLPYFEKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TMEM134 transmembrane protein 134 [ Homo sapiens (human) ]
Official Symbol TMEM134
Synonyms TMEM134; transmembrane protein 134; transmembrane protein 134
Gene ID 80194
mRNA Refseq NM_025124
Protein Refseq NP_079400
UniProt ID Q9H6X4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TMEM134 Products

Required fields are marked with *

My Review for All TMEM134 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon