Recombinant Human TMED9 Protein (40-197 aa), GST-tagged
| Cat.No. : | TMED9-1208H |
| Product Overview : | Recombinant Human TMED9 Protein (40-197 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | Appears to be involved in vesicular protein trafficking, mainly in the early secretory pathway. In COPI vesicle-mediated retrograde transport involved in the coatomer recruitment to mbranes of the early secretory pathway. Increases coatomer-dependent activity of ARFGAP2. Thought to play a crucial role in the specific retention of p24 complexes in cis-Golgi mbranes; specifically contributes to the coupled localization of TMED2 and TMED10 in the cis-Golgi network. May be involved in organization of intracellular mbranes, such as of the ER-Golgi intermediate compartment and the Golgi apparatus. Involved in ER localization of PTPN2 isoform PTPB. |
| Source : | E. coli |
| Species : | Human |
| Tag : | GST |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 45.5 kDa |
| Protein length : | 40-197 aa |
| AA Sequence : | FHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSE |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
| Gene Name | TMED9 transmembrane p24 trafficking protein 9 [ Homo sapiens (human) ] |
| Official Symbol | TMED9 |
| Synonyms | p25; GMP25; p24a2; HSGP25L2G; p24alpha2; |
| Gene ID | 54732 |
| mRNA Refseq | NM_017510 |
| Protein Refseq | NP_059980 |
| UniProt ID | Q9BVK6 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMED9 Products
Required fields are marked with *
My Review for All TMED9 Products
Required fields are marked with *
0
Inquiry Basket
