Recombinant Human TMED9 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TMED9-604H
Product Overview : TMED9 MS Standard C13 and N15-labeled recombinant protein (NP_059980) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is a member of a family of genes encoding transport proteins located in the endoplasmic reticulum and the Golgi. A similar gene in mouse is the target of microRNA miR-296, which is part of an imprinted cluster.
Molecular Mass : 27.3 kDa
AA Sequence : MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRHLKSFFEAKKLVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TMED9 transmembrane emp24 protein transport domain containing 9 [ Homo sapiens (human) ]
Official Symbol TMED9
Synonyms TMED9; transmembrane p24 trafficking protein 9; p25; GMP25; p24a2; HSGP25L2G; p24alpha2; transmembrane emp24 domain-containing protein 9; glycoprotein 25L2; p24 family protein alpha-2; transmembrane emp24 protein transport domain containing 9
Gene ID 54732
mRNA Refseq NM_017510
Protein Refseq NP_059980
UniProt ID Q9BVK6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TMED9 Products

Required fields are marked with *

My Review for All TMED9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon