Recombinant Human TMC8 protein, His-tagged

• Cat.No.: TMC8-3749H
• Product Overview: Recombinant Human TMC8 protein(617-726 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 617-726 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: QTQANARAIHRLRKQLVWQVQEKWHLVEDLSRLLPEPGPSDSPGPKYPASQASRPQSFCPGCPCPGSPGHQAPRPGPSVVDAAGLRSPCPGQHGAPASARRFRFPSGAEL
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: TMC8 transmembrane channel-like 8 [ Homo sapiens ]
• Official Symbol: TMC8
• Synonyms: TMC8; transmembrane channel-like 8; epidermodysplasia verruciformis 2 , EVER2; transmembrane channel-like protein 8; EVIN2; epidermodysplasia verruciformis 2; epidermodysplasia verruciformis protein 2; EV2; EVER2; FLJ40668; FLJ43684; MGC40121; MGC102701
• Gene ID: 147138
• mRNA Refseq: NM_152468
• Protein Refseq: NP_689681
• MIM: 605829
• UniProt ID: Q8IU68