Recombinant Human TJP1, GST-tagged

• Cat.No.: TJP1-240H
• Product Overview: Recombinant Human TJP1(338 a.a. - 638 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Description: This gene encodes a protein located on a cytoplasmic membrane surface of intercellular tight junctions. The encoded protein may be involved in signal transduction at cell-cell junctions. Alternative splicing of this gene results in multiple transcript variants.
• Source: Wheat germ
• Species: Human
• Tag: GST
• Molecular Mass: 58.74 kDa
• AA Sequence: SNGSLRSRDEERISKPGAVSTPVKHADDHTPKTVEEVTVERNEKQTPSLPEPKPVYAQVGQPDVDLPVSPSDGVL PNSTHEDGILRPSMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIREEA VLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKGEVFRVVDTLYNGKLGSWL AIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRADFWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAY E
• Applications: ELISA; WB-Re; AP; Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TJP1 tight junction protein 1 [ Homo sapiens (human) ]
• Official Symbol: TJP1
• Synonyms: TJP1; tight junction protein 1 (zona occludens 1); ZO-1; MGC133289; DKFZp686M05161; zonula occludens 1 protein; tight junction protein ZO-1; 3` partial; zona occludens 1; Zonula occludens protein 1; Tight junction protein 1; OTTHUMP00000174520; zonula occludens 1 protein
• Gene ID: 7082
• mRNA Refseq: NM_003257
• Protein Refseq: NP_003248
• MIM: 601009
• UniProt ID: Q07157
• Chromosome Location: 15q13
• Pathway: Apoptotic cleavage of cell adhesion proteins; E-cadherin signaling in the nascent adherens junction; Gap junction
• Function: calmodulin binding; protein C-terminus binding; protein domain specific binding