Recombinant Dog TJP1 Protein (1633-1769 aa), His-tagged

• Cat.No.: TJP1-833D
• Product Overview: Recombinant Dog TJP1 Protein (1633-1769 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Dog
• Source: E.coli
• Tag: His
• Protein Length: 1633-1769 aa
• Description: The N-terminal may be involved in transducing a signal required for tight junction assbly, while the C-terminal may have specific properties of tight junctions. The alpha domain might be involved in stabilizing junctions. Plays a role in the regulation of cell migration by targeting CDC42BPB to the leading edge of migrating cells.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 18.7 kDa
• AA Sequence: VVATARGVFNNNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSGDPKTWQNKCLPGDPNYLVGANCVSVLIDHF
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: TJP1 tight junction protein 1 (zona occludens 1) [ Canis lupus familiaris ]
• Official Symbol: TJP1
• Synonyms: TJP1; zonula occludens 1; ZO1; ZO-1
• Gene ID: 403752
• mRNA Refseq: NM_001003140
• Protein Refseq: NP_001003140
• UniProt ID: O97758