Recombinant Human TIMM21 Protein (1-248 aa), GST-tagged

• Cat.No.: TIMM21-2125H
• Product Overview: Recombinant Human TIMM21 Protein (1-248 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-248 aa
• Description: Participates in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Also required for assembly of mitochondrial respiratory chain complex I and complex IV as component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex. Probably shuttles between the presequence translocase and respiratory-chain assembly intermediates in a process that promotes incorporation of early nuclear-encoded subunits into these complexes.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 55.2 kDa
• AA Sequence: MICTFLRAVQYTEKLHRSSAKRLLLPYIVLNKACLKTEPSLRCGLQYQKKTLRPRCILGVTQKTIWTQGPSPRKAKEDGSKQVSVHRSQRGGTAVPTSQKVKEAGRDFTYLIVVLFGISITGGLFYTIFKELFSSSSPSKIYGRALEKCRSHPEVIGVFGESVKGYGEVTRRGRRQHVRFTEYVKDGLKHTCVKFYIEGSEPGKQGTVYAQVKENPGSGEYDFRYIFVEIESYPRRTIIIEDNRSQDD
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: TIMM21 translocase of inner mitochondrial membrane 21 homolog (yeast) [ Homo sapiens ]
• Official Symbol: TIMM21
• Synonyms: C18orf55; HSPC154; mitochondrial; TI21L_HUMAN; TIM21-like protein; TIMM21; TIM21
• Gene ID: 29090
• mRNA Refseq: NM_014177.2
• Protein Refseq: NP_054896.2
• UniProt ID: Q9BVV7