Recombinant Human TIA1 protein, His-tagged

• Cat.No.: TIA1-3208H
• Product Overview: Recombinant Human TIA1 protein(1-214 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 1-214 aa
• AA Sequence: MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYECRCIGEEKEMWNFGEKYARF
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: TIA1 TIA1 cytotoxic granule-associated RNA binding protein [ Homo sapiens ]
• Official Symbol: TIA1
• Synonyms: TIA1; TIA1 cytotoxic granule-associated RNA binding protein; TIA1 cytotoxic granule associated RNA binding protein; nucleolysin TIA-1 isoform p40; nucleolysin TIA 1 isoform p40; T cell restricted intracellular antigen 1; p40-TIA-1 (containing p15-TIA-1); T-cell-restricted intracellular antigen-1; TIA-1
• Gene ID: 7072
• mRNA Refseq: NM_022037
• Protein Refseq: NP_071320
• MIM: 603518
• UniProt ID: P31483