Recombinant Human THYN1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : THYN1-2214H
Product Overview : THYN1 MS Standard C13 and N15-labeled recombinant protein (NP_954994) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described.
Source : HEK293
Species : Human
Tag : Myc&DDK
Molecular Mass : 18.8 kDa
AA Sequence : MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMKSLILFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name THYN1 thymocyte nuclear protein 1 [ Homo sapiens (human) ]
Official Symbol THYN1
Synonyms THYN1; thymocyte nuclear protein 1; THY28; thymocyte protein thy28; MY105; MDS012; HSPC144; THY28KD; MGC12187;
Gene ID 29087
mRNA Refseq NM_199297
Protein Refseq NP_954994
MIM 613739
UniProt ID Q9P016

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All THYN1 Products

Required fields are marked with *

My Review for All THYN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon