Recombinant Human THYN1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: THYN1-646H
• Product Overview: THYN1 MS Standard C13 and N15-labeled recombinant protein (NP_054893) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described.
• Molecular Mass: 25.7 kDa
• AA Sequence: MSRPRKRLAGTSGSDKGLSGKRTKTENSVEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQEEFDFVLSLEEKEPSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: THYN1 thymocyte nuclear protein 1 [ Homo sapiens (human) ]
• Official Symbol: THYN1
• Synonyms: THYN1; thymocyte nuclear protein 1; THY28; thymocyte protein thy28; MY105; MDS012; HSPC144; THY28KD; MGC12187
• Gene ID: 29087
• mRNA Refseq: NM_014174
• Protein Refseq: NP_054893
• MIM: 613739
• UniProt ID: Q9P016