Recombinant Human THRB protein, T7/His-tagged

• Cat.No.: THRB-68H
• Product Overview: Recombinant human THRB cDNA (461aa, derived from BC106930) fused with 31 aa T7/His/TEV at N-terminal was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&T7
• Form: 0.1 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFELTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSER RSTLKNEQSSPHLIQTTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYR CITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKVTRNQCQECRFKKCIYVGMATDLVLDDSKRLAKRKLIEEN REKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWKQKRKFLPEDIGQAPIVNAPEGGKVDLEAFS HFTKIITPAITRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGG LGVVSDAIFDLGMSLSSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPK LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
• Purity: >90% by SDS-PAGE
• Applications: 1. As soluble active recombinant protein, may be used for in vitro THRB protein functional study of thyroid hormone pathway regulation.2. As active protein, may be used for EMSA based DNA / protein binding assay.3. As protein substrate for kinase or ubiquitin enzymatic assay.4. As immunogen for specific antibody production.
• Storage: Keep at -20centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
• Protein length: 461 a.a.

Gene Information

• Gene Name: THRB thyroid hormone receptor, beta [ Homo sapiens ]
• Official Symbol: THRB
• Synonyms: THRB; thyroid hormone receptor, beta; ERBA2, pituitary resistance to thyroid hormone , PRTH, thyroid hormone receptor, beta (avian erythroblastic leukemia viral (v erb a) oncogene homolog 2) , thyroid hormone receptor, beta (erythroblastic leukemia vir
• Gene ID: 7068
• mRNA Refseq: NM_000461
• Protein Refseq: NP_000452
• MIM: 190160
• UniProt ID: P10828
• Chromosome Location: 3p24.2
• Pathway: Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem; Nuclear Receptor transcription pathway, organism-specific biosystem; Nuclear Receptors, organism-specific biosystem
• Function: DNA binding; enzyme binding; metal ion binding; protein binding; receptor activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; steroid hormone receptor activity; thyroid hormone receptor activity; transcrip