Recombinant Human THPO protein, His-SUMO-tagged
Cat.No. : | THPO-3577H |
Product Overview : | Recombinant Human THPO protein(P40225)(22-195aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 22-195aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.7 kDa |
AA Sequence : | SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
THPO-7258Z | Recombinant Zebrafish THPO | +Inquiry |
THPO-5714R | Recombinant Rat THPO Protein, His (Fc)-Avi-tagged | +Inquiry |
THPO-3577H | Recombinant Human THPO protein, His-SUMO-tagged | +Inquiry |
THPO-82H | Active Recombinant Human Thrombopoietin | +Inquiry |
THPO-98H | Recombinant Human Thrombopoietin, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
THPO-2832HCL | Recombinant Human THPO cell lysate | +Inquiry |
THPO-2831MCL | Recombinant Mouse THPO cell lysate | +Inquiry |
THPO-2273CCL | Recombinant Cynomolgus THPO cell lysate | +Inquiry |
THPO-001HCL | Recombinant Human THPO cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All THPO Products
Required fields are marked with *
My Review for All THPO Products
Required fields are marked with *
0
Inquiry Basket