Recombinant Active Human THPO Protein, His-tagged(N-ter)

Cat.No. : THPO-305H
Product Overview : Recombinant Active Human THPO Protein with His tag (N-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : Megakaryocytopoiesis is the cellular development process that leads to platelet production. The main functional protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. Mutations in this gene are the cause of thrombocythemia 1. Alternative promoter usage and differential splicing result in multiple transcript variants differing in the 5' UTR and/or coding region. Multiple AUG codons upstream of the main open reading frame (ORF) have been identified, and these upstream AUGs inhibit translation of the main ORF at different extent. [provided by RefSeq, Feb 2014]
Form : Powder
Bio-activity : Determined by its ability to induce proliferation in MO7e cells. The ED50 for this effect is < 2 ng/mL. The specific activity of recombinant human TPO is > 5 x 10^5 IU/mg.
AA Sequence : SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL
Endotoxin : Endotoxin level is less than 0.01 EU/μg of the protein, as determined by the LAL test.
Purity : > 95% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : PBS (pH 7.4)
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name THPO thrombopoietin [ Homo sapiens (human) ]
Official Symbol THPO
Synonyms THPO; thrombopoietin; ML; TPO; MGDF; MKCSF; MPLLG; THCYT1; thrombopoietin; MPL ligand; c-mpl ligand; megakaryocyte colony-stimulating factor; megakaryocyte growth and development factor; megakaryocyte stimulating factor; myeloproliferative leukemia virus oncogene ligand; prepro-thrombopoietin; thrombopoietin nirs
Gene ID 7066
mRNA Refseq NM_000460
Protein Refseq NP_000451
MIM 600044
UniProt ID P40225

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All THPO Products

Required fields are marked with *

My Review for All THPO Products

Required fields are marked with *

0

Inquiry Basket

cartIcon