Recombinant Human TGM1 protein, GST-tagged
Cat.No. : | TGM1-1206H |
Product Overview : | Recombinant Human TGM1 protein(467-817 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 467-817 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | SGIFCCGPCSVESIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAISSNMREDITYLYKHPEGSDAERKAVETAAAHGSKPNVYANRGSAEDVAMQVEAQDAVMGQDLMVSVMLINHSSSRRTVKLHLYLSVTFYTGVSGTIFKETKKEVELAPGASDRVTMPVAYKEYRPHLVDQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQSFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPAPGDGGFFSDAGGDSHLGETIPMASRGGA |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TGM1 transglutaminase 1 (K polypeptide epidermal type I, protein-glutamine-gamma-glutamyltransferase) [ Homo sapiens ] |
Official Symbol | TGM1 |
Synonyms | TGM1; transglutaminase 1 (K polypeptide epidermal type I, protein-glutamine-gamma-glutamyltransferase); ICR2; protein-glutamine gamma-glutamyltransferase K; LI; LI1; TGASE; TGK; TG(K); TGase K; TGase-1; epidermal TGase; transglutaminase K; transglutaminase-1; transglutaminase 1 isoform; transglutaminase, keratinocyte; KTG; |
Gene ID | 7051 |
mRNA Refseq | NM_000359 |
Protein Refseq | NP_000350 |
MIM | 190195 |
UniProt ID | P22735 |
◆ Recombinant Proteins | ||
Tgm1-6395M | Recombinant Mouse Tgm1 Protein, Myc/DDK-tagged | +Inquiry |
TGM1-1780D | Recombinant Dog TGM1 protein, His & GST-tagged | +Inquiry |
TGM1-1420HFL | Recombinant Full Length Human TGM1 Protein, C-Flag-tagged | +Inquiry |
Tgm1-1782M | Recombinant Mouse Tgm1 protein, His & GST-tagged | +Inquiry |
TGM1-6041R | Recombinant Rat TGM1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGM1-1111HCL | Recombinant Human TGM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TGM1 Products
Required fields are marked with *
My Review for All TGM1 Products
Required fields are marked with *
0
Inquiry Basket