Recombinant Human TFRC protein(91-170 aa), C-His-tagged

• Cat.No.: TFRC-2532H
• Product Overview: Recombinant Human TFRC protein(P02786)(91-170 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 91-170 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: GVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVE
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: TFRC transferrin receptor (p90, CD71) [ Homo sapiens ]
• Official Symbol: TFRC
• Synonyms: TFRC; transferrin receptor (p90, CD71); transferrin receptor protein 1; CD71; TFR1; T9; TR; TFR; p90; TRFR
• Gene ID: 7037
• mRNA Refseq: NM_001128148
• Protein Refseq: NP_001121620
• MIM: 190010
• UniProt ID: P02786