Recombinant Human TFF3 protein, GST-tagged

• Cat.No.: TFF3-3564H
• Product Overview: Recombinant Human TFF3 protein(Q07654)(29-80aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 29-80aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 33.2 kDa
• AA Sequence: ANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: TFF3 trefoil factor 3 (intestinal) [ Homo sapiens ]
• Official Symbol: TFF3
• Synonyms: TFF3; trefoil factor 3 (intestinal); trefoil factor 3; HITF; ITF; polypeptide P1.B; P1B; TFI
• Gene ID: 7033
• mRNA Refseq: NM_003226
• Protein Refseq: NP_003217
• MIM: 600633
• UniProt ID: Q07654