Recombinant Human TFF2 Protein, His-tagged

Cat.No. : TFF2-588H
Product Overview : Recombinant Human TFF2 fused with His tag at C-terminal was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 24-129 a.a.
Description : Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. The encoded protein inhibits gastric acid secretion. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21.
Form : Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
Molecular Mass : 13kD
AA Sequence : EKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHYVDHHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name TFF2 trefoil factor 2 [ Homo sapiens ]
Official Symbol TFF2
Synonyms TFF2; trefoil factor 2; SML1, spasmolytic protein 1; spasmolysin; spasmolytic protein 1; spasmolytic polypeptide; SP; SML1;
Gene ID 7032
mRNA Refseq NM_005423
Protein Refseq NP_005414
MIM 182590
UniProt ID Q03403

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TFF2 Products

Required fields are marked with *

My Review for All TFF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon